PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000479m
Common NameEUTSA_v10000479mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family M-type_MADS
Protein Properties Length: 204aa    MW: 23247.9 Da    PI: 9.8989
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000479mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-221961345
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     i+ +s rqvtfskRr+g++KKA+EL++LC+ae+a+i+fs+  k
  Thhalv10000479m 19 IKKESHRQVTFSKRRAGLFKKASELCTLCGAEIAIIVFSPAKK 61
                     8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.717969IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-30968IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-281089IPR002100Transcription factor, MADS-box
CDDcd002655.32E-341078No hitNo description
PRINTSPR004042.7E-171131IPR002100Transcription factor, MADS-box
PfamPF003199.8E-261865IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MTSKKKESIG RQRIPMVKIK KESHRQVTFS KRRAGLFKKA SELCTLCGAE IAIIVFSPAK  60
KPFSFGHPSV ESVLDRYMSR NNMSMAQTRN PAASCELNMR LTQILSEVEE EKKKGQAMEE  120
MRRENARRAM INWWEGPVEE MNMVQLQEMK FALEELRKTV LLETNKEDVF GFLDNKVTTV  180
PSYMNMSSGL PNTSNFAYGN GCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-151081172Myocyte-specific enhancer factor 2A
3kov_B1e-151081172Myocyte-specific enhancer factor 2A
3kov_I1e-151081172Myocyte-specific enhancer factor 2A
3kov_J1e-151081172Myocyte-specific enhancer factor 2A
3p57_A1e-151081172Myocyte-specific enhancer factor 2A
3p57_B1e-151081172Myocyte-specific enhancer factor 2A
3p57_C1e-151081172Myocyte-specific enhancer factor 2A
3p57_D1e-151081172Myocyte-specific enhancer factor 2A
3p57_I1e-151081172Myocyte-specific enhancer factor 2A
3p57_J1e-151081172Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405049.11e-151hypothetical protein EUTSA_v10000479mg
SwissprotQ4PSU41e-119AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLV4LVK61e-151V4LVK6_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0004_5411e-118(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-109AGAMOUS-like 61